SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026321 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026321
Domain Number 1 Region: 887-1164
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-71
Family Protein kinases, catalytic subunit 0.00000742
Further Details:      
 
Domain Number 2 Region: 575-871
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.84e-44
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 3 Region: 452-552,581-607
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000398
Family SH2 domain 0.0071
Further Details:      
 
Domain Number 4 Region: 371-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000209
Family Third domain of FERM 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000026321
Domain Number - Region: 147-276
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00023
Family Second domain of FERM 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026321   Gene: ENSCAFG00000017834   Transcript: ENSCAFT00000028302
Sequence length 1185
Comment pep:known_by_projection chromosome:CanFam3.1:20:50748452:50773201:1 gene:ENSCAFG00000017834 transcript:ENSCAFT00000028302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVKSMPLCHSGATTRDSRPDGDEAQPLATRGGLKVLLHWAGPGGGDPWVTFSEATLTAED
VCIHIAHKVGITPSCFNLFALFDAEAQVWLPPNHILEVSGDMNLTLYFRMRFYFRNWHGT
NSQEPAVYRCGPTGTKSSSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVASLWDLSSEEE
IHHFKNESLGMAFLHLCHLALSHGIPLEKVAKKIRPPSFKDCIPRSRLQIRRHNALTRLR
LRSIFRRFVRAFQPGHISQQVIMVKYLATLEQLAPFGTERVPVCHLELLAQAVGESCYIR
DSGQAPPEPELATGPPTHEVLVTGTGGIQWRPVQAESPRGDSSSRNRHADPFRKKTKAGE
VGDQPVDRPQEEPWVYFCDFQDITHVVLKERHISIHCQDNKSLELTLPSRAMALSWVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLMEPFVLAKLRSEDGLYLIHWSTSHL
NRLILTVAQRDQSPGTQRLHLRKFPIELQAGVFRLEGWDRSFPSVRELRAALQGCSLRAG
DDCFSLRRCCLPRPGEISNLIIMRGPRAVTSPPNVSQLSFHRICQADVTQLSHLGQGTRT
NVYEGVLRVGARAPKEGAADGEDPPTPSEDSGLELRVVLKVLDPSHHDIALAFYETASLM
SQVSHVHLAFVHGICVYGSENIMVTEYVEHGPLDVWLRREKGHVPVAWKVAVAQQLASAL
SYLEDKSLVHGNVCGRNILLARLGLEEGTSPFIKLSDPGVGLGALSREERIERIPWIAPE
CLTGGANSLTTAADKWGFGATLLEICFDGEAPLQGRGPSEKECFYQKQHLLPQPSCPELA
TLISQCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFHKRYLKKIRD
LGEGHFGKVSLYCYDPTNDGTGEMVAVKAIKAGCGPQLRTCWRREIDILRTLHHKHIVKY
KGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYVHR
DLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYAS
DVWSFGVTLYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPRPEKCPY
EIYLLMKNCWEAEASFRPTFQNLIPILKTVQEKYQGQAASVFNVC
Download sequence
Identical sequences F1PBD0
ENSCAFP00000026321 ENSCAFP00000026321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]