SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026634 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026634
Domain Number 1 Region: 231-331
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-30
Family Phosphotyrosine-binding domain (PTB) 0.0000165
Further Details:      
 
Domain Number 2 Region: 78-197
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-16
Family Phosphotyrosine-binding domain (PTB) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026634   Gene: ENSCAFG00000018028   Transcript: ENSCAFT00000028636
Sequence length 1278
Comment pep:known_by_projection chromosome:CanFam3.1:X:82284457:82292491:-1 gene:ENSCAFG00000018028 transcript:ENSCAFT00000028636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCSCARDQATRRLSAAAAATAAALAVVATTPLLPLGTSTALIGTGSSCPGAMWLSTAT
GSRSDSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTPGAQPDGEPTALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVLFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSTRRH
LDTLPREPGGWLRRSRFEQFCHLRAIGDGEDEMLLARRYMTPSEPVLPSRRGRLHLPRAR
RSRRAISVPASLCRRLPPSPVRVPHPAEVPNDRACLSPEASGSGNSGDEGSPQGQEGQEG
NGGDYMPMNNWGSGNGRGSGGGQGASGQGSSSQSSGGNQCSGGGQGSGGGQDSSGGQGSG
GQGMGGNQRSGAGQGTAGGHGSGGGQGAGGGHGSGDGQGPGDGHGSRRGKNSGGGKGSGG
GKTSDGSGDRGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGATGGKGKSGGRFRLY
FCADRGAQKDRKEAKEVKDKADSPEGAARGPLRARAFDEDEDDPYVPMRPGVAAPLASSS
DYMPMAPQNFSASKHHSRSPFEDSRGYMMMFPRMSPPPAPSAQKEPDPEKEDESKDNDSE
SDYMFMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFQGSPLGRSDHSEYVPMLPGKF
LGNSLDKAPTSNWGPKHAVSKPPVEGSFSKPRDGGTCWKPSDNGPPKNKAKRPNRLSFIT
KGNKIKPKSQKPTRAQREADSSSVYVNIDFTKSGSNMPAPFIQGLPGSWGIMAGPRPSAF
SHYVNVEFEVLFPHPAQNFSHLFRAIPGANPLFLEGARWPLVPLPPSATGGSASEEEGDY
IEVIFNPAMTPAVPFGDSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQ
EEQQLERRRPQDRSQSFFPSARAAVSAFPTDSLERDLPASLASAAAAAAASAAAPALALG
RALAAASALAAAPGIGAAARGLEAAAGFDSASVRWFQPVAGSAAAAAAAVRGTQAVAAGS
NPRARHPSADLAGGENWATAAVSPPPPPPPPRRPVPSPPEQQVSDNDDDDDDDDTYVRMD
FARPDNKKSDSPRRDCQK
Download sequence
Identical sequences E2RLU4
ENSCAFP00000026634 XP_013967477.1.84170 ENSCAFP00000026634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]