SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026844 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026844
Domain Number 1 Region: 56-395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-80
Family Protein kinases, catalytic subunit 0.00000212
Further Details:      
 
Domain Number 2 Region: 1014-1080
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.17e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 1098-1214
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000229
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 4 Region: 1245-1447,1480-1521
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000392
Family Tricorn protease domain 2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000026844
Domain Number - Region: 439-552
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026844   Gene: ENSCAFG00000018159   Transcript: ENSCAFT00000028866
Sequence length 1712
Comment pep:known_by_projection chromosome:CanFam3.1:8:70806998:70916342:-1 gene:ENSCAFG00000018159 transcript:ENSCAFT00000028866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAK
PFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETAC
FREERDVLVNGDCQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFY
IGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPD
VSSPSDTSNFDVDDDVLRNIDILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQ
SSTLTKDEGVQRDLENSLQVEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGS
SARDKEIKKLNEEIERLKNKIADSNRLERQLEDTVTLRQEHEDSTHRLKGLEKQYRVVRQ
EKEVFHKQLVEASERLKSQARELKDAHQQRKLALQEFSELNERMAELRSQKQKVSRQLRD
KEEEVEVAMQKIDSMRQEIRKSEKFRKELEARLEDAVAEASRERKLREHSENFSKQVESE
LEALKMKQGGRGPGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEVLMLKDKLEKSKRERHTEMEEAVGTVREKYERERGMLLEENKKLTAEN
ERLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS
KMTEELETLRSSSLGSRALDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKV
KDTNLSFESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRSGSAAEQETQAPKPEASPSVSVAASTEQQEDMARAPQRPPTVPLPTTQPLTLA
GPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKESAPQVCPIPP
EQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQP
GVVASQVLDLRDEEFSVSSVLASDVIHASRRDIPCIFRVTASLLGTPSKTSSLLILTENE
NEKRKWVGILEGLQSILHKNRLRNQVVHIPQEAYDSTLPLIKAVLSAAVVDGDRIAVGLE
EGLYVIELTRDVIVRVADYKKVYQIELAPKEKVAVLLCGRNHHVHLCPWSAFDGAESNVD
IKLPETKGCQLIATATLRKSSSTCLFAAVKRLVLCYEVQRTRPFHRKVNEIVAPGTVQWM
AALKDKLCVGYPSGFSLLSPQGDGQALTLVNPNDPSLTFLSQQSFDALCAVELKSEEYLL
CFSHMGLYVDPQGRRSRMQELMWPAAPVACSCSPSHVTVYSEYGVDVFDVRTMEWVQTIG
LRRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGTVLNVPDTSDNSKKQMLRTRSKRRFVFK
VPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEER
PGPAPPSLSRQPVPRNKPYISWPSSGGPEPGVAVPLRSMSDPDQDFDKEPDSDSTKHSTP
SNSSNPSGPPSPNSPHRSQLPLEGLEQPAYDA
Download sequence
Identical sequences E2RPP4
XP_868604.3.84170 ENSCAFP00000026844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]