SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026905 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026905
Domain Number 1 Region: 476-615
Classification Level Classification E-value
Superfamily Cyclin-like 2.1e-19
Family Cyclin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026905   Gene: ENSCAFG00000018207   Transcript: ENSCAFT00000028927
Sequence length 631
Comment pep:known_by_projection chromosome:CanFam3.1:7:65009239:65124186:-1 gene:ENSCAFG00000018207 transcript:ENSCAFT00000028927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAACSSASSRGSSSSAGTDAAGTSGLQPPPPQPQPQPQPQPQPAAAAPAPPPPEPPRKP
RMDPRRRQAALSFLTNISLDGRPPLQDEEWGGGEDRGAAKPGAGSACGERTRLSLLAAAE
RGGXXXXAAAAAGWGPCPPQSAPLPALAPGGHAAGLAPGAPRGFLSPLGAGRASGEQPQP
PRPAPPASCAPPQLPDAPGNAGQEELEEDDAFCSVQVPAAAFLGSGTPGSGSGSRGRLNS
FTQGILPIAFARPTSQNYCALEQPAQGASASALEQLQRSRRRLISQRSSLETLEDIEENA
PLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSAQV
GDLKLDGGKQSSGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSF
SQFRNLSHRSLSIGRASSTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYM
TTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGFEEPTVAMAF
VYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIA
FEFPVLVALEFALHLPEHEVMPHYRRLIQSS
Download sequence
Identical sequences F1P9I2
ENSCAFP00000026905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]