SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026914 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026914
Domain Number 1 Region: 238-475
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-57
Family DBL homology domain (DH-domain) 0.0000323
Further Details:      
 
Domain Number 2 Region: 473-599
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-37
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026914   Gene: ENSCAFG00000018211   Transcript: ENSCAFT00000028936
Sequence length 1170
Comment pep:known chromosome:CanFam3.1:20:52262155:52280820:1 gene:ENSCAFG00000018211 transcript:ENSCAFT00000028936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVGTNFLPSRPAVSANTVGEDAALSRRITWRYKNSTARPRTALGLGAPTVNMGNTHSK
SSDRDSALHGRPELSFYSSFPRKWSENVFLDNELLTTKILSVLRPQSERGFRPGHLRYPA
HFLSTNSVFASVAASLKEHPRATLVSDGSSALSRNVGMTVSQKGGPQPAPSPVGTGTQLG
PVTGEMDEADSVFLKFKQAADDSLSLTSSNAEPIFVEDPCTASLRSEIESDAREFEAESW
SLSVDAAYAKKQKREVVKRQDVLYELVQTEAHHVRTLKIMLKVYSRALQEELQFSSKAIS
RLFPCVDELLDIHSHFLSRLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGENGDRMKEK
YGVFCSGHNEAVNHYKLLLQQNKKFQSLIKKIGNFSIVRRLGVQECILLVTQRITKYPVL
VERIIQNTEAGTEDYRDLTQALNLIKDIISRVDAKVSECEKGQRLREIAGKMDLKSSSKL
KNGLTFRKEDMLQRQLHLEGTLCWKTTSGRLKDVLAVLLTDVLLLLQEKDQKYVFASVDS
KRPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEERNTWMAHIRRAVESCP
DEEEGPFSEAEEEKKGLEARALRLRDFQERLNVKDQQIAQSLGEKQQIYLEMAEMSGLED
VAQSRLLFRGGDPSETMQGEQILKSAMSEIEDIQTLICRQLGSANGQAEDAGGSSGLPRR
AETFGGYDTVSSPSKNGILKKTCSSDPSPRDWQGPVSSPDLKPSNTLGASEEAPPAGPVP
GADCGPHLPAVLELELVQRIQTLSQLLLSLQAVIAQQDSYVEMQRASIQEREKQLRLQST
RGNMLLEQERQRNFEKQREELAGVQKQQGRLRLEQQRWERERERQQQELDLAAARLQRRE
NESLQLQEQLSQEREKLEQQRRAYQHDLERLREAQRAVEREREQLEQQRRLKKQNTVPGA
LPPDSLAEAQPPSHTPSFNGEGLEGPTTLAKAPGPRVSVLLSGSGPEFTERPEVARRDSA
PTESRPAKSDVPIQLLSTTNQIQRQAAVQQQIPTKLAASTKGGKDKGGKSRGSQRSDSSA
SFDLKQQLLLSKLMGKDENASRNRRSLSPVLLSSHSSVAPPDPCCPAPPDVPAEGCSLKP
GGGPVPPSPLPLPTTPLSKEESSKEDVIFF
Download sequence
Identical sequences E2RKN0
ENSCAFP00000026914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]