SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026917 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026917
Domain Number 1 Region: 426-663
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-57
Family DBL homology domain (DH-domain) 0.0000323
Further Details:      
 
Domain Number 2 Region: 661-787
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-37
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000026917   Gene: ENSCAFG00000018211   Transcript: ENSCAFT00000028939
Sequence length 1358
Comment pep:known chromosome:CanFam3.1:20:52208318:52282325:1 gene:ENSCAFG00000018211 transcript:ENSCAFT00000028939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEQEDGIPQFRDSLEDLSLDLGALQGSEYLQDLGLGAFADSQPEGPRDSGLTSEEAGG
ESTLSSSAEPQTLPRRRSWERSRSCSESWERLSFSASAMNEGPCLPRTLASLALNQPGED
LQAWTKECLSRAGTPAEHPGKECDSPEKRVRSRSVPLSFDEISSLEISRALEVPTPAPQG
LAPPVLECMEKDHVEPEHVLIVQQVLEELRHYHGARQRARLSVSPAGGHSNLTWFEFLSE
SEDGASKTERSDRSTRVKRRLSSLRCRVTRQKEKGKNPTPAKDKGQDARERKECINGHQL
AQGTFLGHPSCPLCGKPFLSSASLKEHPRATLVSDGSSALSRNVGMTVSQKGGPQPAPSP
VGTGTQLGPVTGEMDEADSVFLKFKQAADDSLSLTSSNAEPIFVEDPCTASLRSEIESDA
REFEAESWSLSVDAAYAKKQKREVVKRQDVLYELVQTEAHHVRTLKIMLKVYSRALQEEL
QFSSKAISRLFPCVDELLDIHSHFLSRLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGE
NGDRMKEKYGVFCSGHNEAVNHYKLLLQQNKKFQSLIKKIGNFSIVRRLGVQECILLVTQ
RITKYPVLVERIIQNTEAGTEDYRDLTQALNLIKDIISRVDAKVSECEKGQRLREIAGKM
DLKSSSKLKNGLTFRKEDMLQRQLHLEGTLCWKTTSGRLKDVLAVLLTDVLLLLQEKDQK
YVFASVDSKRPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEERNTWMAHI
RRAVESCPDEEEGPFSEAEEEKKGLEARALRLRDFQERLNVKDQQIAQSLGEKQQIYLEM
AEMSGLEDVAQSRLLFRGGDPSETMQGEQILKSAMSEIEDIQTLICRQLGSANGQAEDAG
GSSGLPRRAETFGGYDTVSSPSKNGILKKTCSSDPSPRDWQGPVSSPDLKPSNTLGASEE
APPAGPVPGADCGPHLPAVLELELVQRIQTLSQLLLSLQAVIAQQDSYVEMQRASIQERE
KQLRLQSTRGNMLLEQERQRNFEKQREELAGVQKQQGRLRLEQQRWERERERQQQELDLA
AARLQRRENESLQLQEQLSQEREKLEQQRRAYQHDLERLREAQRAVEREREQLEQQRRLK
KQNTVPGALPPDSLAEAQPPSHTPSFNGEGLEGPTTLAKAPGPRVSVLLSGSGPEFTERP
EVARRDSAPTESRPAKSDVPIQLLSTTNQIQRQAAVQQQIPTKLAASTKGGKDKGGKSRG
SQRSDSSASFDLKQQLLLSKLMGKDENASRNRRSLSPVLLSSHSSVAPPDPCCPAPPDVP
AEGCSLKPGGGPVPPSPLPLPTTPLSKEESSKEDVIFF
Download sequence
Identical sequences F1P9G9
ENSCAFP00000026917 ENSCAFP00000026914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]