SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027021 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027021
Domain Number 1 Region: 73-416
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 947-1013
Classification Level Classification E-value
Superfamily G protein-binding domain 9.68e-22
Family RhoA-binding domain 0.0000463
Further Details:      
 
Domain Number 3 Region: 1117-1207,1289-1320
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000661
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 1226-1275
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000113
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 5 Region: 426-527
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000194
Family Myosin rod fragments 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000027021
Domain Number - Region: 626-707
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027021   Gene: ENSCAFG00000018282   Transcript: ENSCAFT00000029058
Sequence length 1372
Comment pep:known_by_projection chromosome:CanFam3.1:7:66862559:67031827:1 gene:ENSCAFG00000018282 transcript:ENSCAFT00000029058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGDSFEARFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRSSPNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVEHEVSTLKDQLEDLKKVNQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNRELQERNRILENSKTQMD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDLLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEESNSMLTKDNELLRKENE
ELTDKMKRAEEEYKLKKEEEINNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHKNELQMQL
ASKESDIEQLRAKLLDLSDSTSIASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTSSPSWEVNLKCACNPSSTK
Download sequence
Identical sequences F1PU60
ENSCAFP00000027021 ENSCAFP00000027021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]