SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027037 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027037
Domain Number 1 Region: 40-105,153-290
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-24
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 317-482
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-22
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027037   Gene: ENSCAFG00000018303   Transcript: ENSCAFT00000029078
Sequence length 743
Comment pep:known_by_projection chromosome:CanFam3.1:4:59616772:59649810:-1 gene:ENSCAFG00000018303 transcript:ENSCAFT00000029078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPC
KGASPEPAKSPPLRHAADLPPPLPQRPPPEDYYEEALPLGPGKSPEYISSHSAAPSANPT
DGCSPAHSIMDGYYEDADSSYPATRMNGELKNSYNDSDPMSSSYESYDEEEEEGKGPQPT
HQWPSEEASMHLVRDCRICAFLLRKKRFGQWAKQLTVIKEDQLLCYKSSKDRQPHLRLAL
DVCSVTYVPKDSRHKRHELRFSQGATEVLVLALQSREQAEEWLKVIREVSKAAGVTEGAD
VPRSPVLLCKLDLDKRLSQEKQTSDSDSLSMGDSCSTLGRREACDHGKGKKSSLAELKGS
VSRAAGRKITRIISFSKKKPLADDLQTSCPDEEVPCCGYLNVLVNQGWKERWCRLKCNTL
YFHKDHTDLRTHVNAIALRGCEVAPGFGPRHPFAFRILRNRQEVAILEANCSEDMGRWLG
LLLVEMGSRVTPEALHYDYVDVETLTSIVSAGRNSFLYARSCQDQWPEPRVYDDVPYEKI
QDEEPKRPAGAQVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVE
KERLEKEKETIRTELMALRQEKRELKEAIRNNPGAKLKVLEEAVASLEAQCRAKEERRID
LELRLVAVKERLQHSLAGGPALGLSVSSKNKSGETANKPQNNAAEQPLPVNCISELRKRS
PSIVTSNQGRVLQKAKEWEMKKT
Download sequence
Identical sequences F1PU51
ENSCAFP00000027037 ENSCAFP00000027037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]