SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027129 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027129
Domain Number 1 Region: 27-103
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000128
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 204-305,386-461
Classification Level Classification E-value
Superfamily RNI-like 0.000000000863
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027129   Gene: ENSCAFG00000018356   Transcript: ENSCAFT00000029171
Sequence length 1188
Comment pep:known_by_projection chromosome:CanFam3.1:4:60360059:60407737:-1 gene:ENSCAFG00000018356 transcript:ENSCAFT00000029171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRKKSVKTCLMNNEIAEETISDETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDNDNNAQNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADA
LNEMEDMVPEDGEVVAASGQETAARSQPVIPVDVDEEQAGPSGLQRVVKPTPITVHDSES
DDEEDSLELQEVWIPKNGARRYSEREEKSGESVQSRELSVSGKGKTPLRKRYNSHQMGQS
KQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSATASTVGTSSSHST
ASQSPDFVRTVNSGGSSEPSPSEVDVSRQCVCSPGGSEDSEAMEEGDAESSVCPRCCCHR
PQESQRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGSG
ATGEDRRGSFQPESYDVQSNEDYPRRPLTRARSRLSHVPLVSESEVAKTKPRHAMKRKRT
ADKSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLK
HLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFS
GPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEDDLKKYPK
YPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQ
LSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI
Download sequence
Identical sequences E2RJY8
ENSCAFP00000027129 ENSCAFP00000027129 XP_546317.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]