SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027136 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027136
Domain Number 1 Region: 147-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-88
Family Protein kinases, catalytic subunit 0.000000000444
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-25
Family Pleckstrin-homology domain (PH domain) 0.000000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027136   Gene: ENSCAFG00000005388   Transcript: ENSCAFT00000029180
Sequence length 446
Comment pep:known_by_projection chromosome:CanFam3.1:1:113380376:113406135:1 gene:ENSCAFG00000005388 transcript:ENSCAFT00000029180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQSFCHPSSLRSPLRLTPGTLTTSSLPSPSQ
SRPRTAVSVWPSPGGLAGGWRARVCP
Download sequence
Identical sequences F1PSA7
ENSCAFP00000027136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]