SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027187 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027187
Domain Number 1 Region: 120-220
Classification Level Classification E-value
Superfamily Cyclin-like 6.08e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily Cyclin-like 7.78e-26
Family Transcription factor IIB (TFIIB), core domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027187   Gene: ENSCAFG00000018408   Transcript: ENSCAFT00000029237
Sequence length 616
Comment pep:known_by_projection chromosome:CanFam3.1:8:72589657:72632264:-1 gene:ENSCAFG00000018408 transcript:ENSCAFT00000029237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGKTPTLGGGFHVNLGKESRAQTLQNGRRQIHHLGNQLQLNQHCLDTAFNFFKMAVSKH
LTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAI
DPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHD
FRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTVDEFMRIDLEGECDPPSYTAGQRKL
RLKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALATLTRDGSVEDTTSSLFG
EEDPEDEELEAVASHLNKDFYQELLGDSISSSSEVAGGAEGGSRPPALESLLGPLPTAAS
LGISDSIRECISSQSQDPTDPCGDGELDLSGIDDLEIDRYILNEAEARVKAELWMRENAE
YLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAGEAIEKMLEQKKISSKINY
SVLRDLNSKGGGSVPGEDTRAEERASARKLSRRKTPASRSGADPVTSVGKRLRPMVSAQP
AKKAAVGETVLPSPPALGAEAVRPAAVVESGPVSYHPEEDPDEEDPDEEDGEPCVSALQM
MGSNDYGCDGEEDDGY
Download sequence
Identical sequences F1PRK4
ENSCAFP00000027187 9615.ENSCAFP00000027187 ENSCAFP00000027187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]