SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027324 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027324
Domain Number 1 Region: 261-357
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-24
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000056
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000027324
Domain Number - Region: 598-662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027324   Gene: ENSCAFG00000018501   Transcript: ENSCAFT00000029387
Sequence length 2188
Comment pep:known chromosome:CanFam3.1:5:42223652:42287524:-1 gene:ENSCAFG00000018501 transcript:ENSCAFT00000029387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIISGWLEMLMVY
PRTNKQNQKKKRKVEPPTPQEPGPAKMAVTSSSSSSSIPSAEKVPTTKSTLWQEEMRAKD
QPDGGSLSPAQSPSQSQPPAASTLREPGLESKDEESTMSSDRMDCGRKVRVESGYFSLEK
TKQDLKAEEQQLPPPLSPPSPSTPNNRRSQVIEKFEALDIEKAEHMETNSSSGPSPSSDT
RQGRSEKRAFPRKRPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRDSAAEEAADL
DGEIDLSTCYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTSAPD
VTSSLPEEKNRSSSSFETCPRPSEKPDMERGEPDPEQKRSRARERRREGRSKTFDWAEFR
PIQQALAQERASTTGISDTHPEAEAGELERERARRREERRKRFGMLDATDGPGADDTALR
MEVDRSPGLPVTTDLKTQNVHVEIEQRWHQVETTPLREEKQVPIAPLHLSSEDGGDRLST
HELTSLLEKELEQSQKEASDLLEQNRLLQDQLRVALGREQSAREGYVLQTEVATSPSGAW
QRLHRVNQDLQSELEAQCQRQELVTQQIQSLKRSYGEAKDAIRHHEAEIRSLQARLSNAA
AELTIKEQALAKLKGDLKLERDKVREQLEERQHREAALSGQLQASEQKLKSAEALLLEKT
QELRDLETQQALQRDRQKEVQRLQDRIADLSRQLGASERAQRLMEEKLQANYELLLESCE
KEKQVLLRNLKEMEDKASAYEDQLQDREQQMEVLQKEKLSAKFEGSEVVHRLEEQLQMKE
ASIQKLAEHVQSLRDERDLIRQRFQELMDRVTLSDGDMAELQEKLSVREADYQSLEHSYR
RVAGQLQSMHMLLKEKEEELKHIKEMHEKVLEKKEQDLNEALVKMVALGSSLEETETKLQ
AKEEILRRLGKEFSEDAEEPQSCLEEAGDGTVLSGPRLQAAGSPPASQHSRLEDEDPGAV
LVEERGDSSPKREESMASLKSEVPDREGPPQSTAKPDQGGSGVKRQRIRFSTIQCQKYTH
PDGSEKTWTSSTSSDTSQDRSPSEESMSSEATPSSLPATSDSDTYLSIIHSLETKLYITE
EKLKDVTVKLESQQGQSQEALLALHQQWAGTEARLREQLRASLLQVGALASQLEQERQAR
AKIVENHVGELGDFQMKNSQALACLENCREQLRSLPAASQEEAQDTGAGPLASTEGTLIS
THPAMRHWSTPSDSAAQAQPEDSSFLEIRKALSQPPHRPELTEQEQLKLLSDQIALEASL
INQIAESLKNTTSDISRVLHEISQSGNLPLEPESVALCPGATADTWAKKLLVDGEFWSQV
ESLSKRLGTQRGEAADASRGEPQSVPAALVPALADATWVRAELNFALQSVRESFQRRLQS
IQETLQGTQVALQQHKRVLGDILGAYRTPDFERVMQQVSEALKLPSGIEDNVQASWDLSP
LGEVLSHQKAASSQEPFFVAHQSSGALVAIQEELALQLKDKASLLWEISAALTSLPPVES
VRDCQKLLQASQNLSWNTYLGGLGQYSSLLVQDAIIQAQVCYAACRIRLEYEKELQCYKE
SWQSRGASCQEHEQAVGALREEYEELLRKQKSEYLEVIAIVERENADLKARVTQLDRQQR
CLEEVESKHSENMFALQGRYEEEMRCVVEQLNRAGDTLQAEHSRVLSQLDASVRDRQDME
RQHVEQMQSLEDRFQLKIRELQSIHEEELRTLQEHYSRSLQCLQEALHHYQRRHPEALPA
PSSPPSWPTSQPRDTLQAASGEAESMTGLRERIQELEAQMDTMREELGQKDLEGSAATLR
EKYQKDFENLKATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATIS
AIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSVQRELEVLSEQYSQK
CLENAHLAQALEAERQALRQCQRENQELNAHNQELNNRLAAEIARLRTLLTGDAGGEATG
SPLTQGKDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSI
VRAKADCDISRLKEQLKAATEALGEKSPENTPVSGYDIMKSKSNPDFLKKDRSCVSRQLR
NIRSKSLKEGLTVQERLKLFESRDLKKD
Download sequence
Identical sequences E2RNJ6
ENSCAFP00000027324 ENSCAFP00000027324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]