SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027414 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027414
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 6.67e-37
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027414   Gene: ENSCAFG00000018575   Transcript: ENSCAFT00000029492
Sequence length 804
Comment pep:known_by_projection chromosome:CanFam3.1:7:71774099:71862238:-1 gene:ENSCAFG00000018575 transcript:ENSCAFT00000029492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPEQEAEPQEAAGTQGPVGAPQGPGPEPSGEEQHQVLEQFEAAAHSTPV
KKEVTDKEREFAAGAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLD
GSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSG
AWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTKGIS
QTNLITTVTPEKKAEEERDEEEDRRKKAEEATPVAAARHEGKTDSERTDTAADGETTATE
ELDKTQDDLMKHQTNISELKRTFLETSTDTAITNEWEKRLSTSPVRLAARQEDAPMIEPL
VPEEKTETKTESSKTETETSHLAPSPQPLSTEKEETAAASHEPEEEQSTTTHVPETREQK
PHFESSTVKTESLSFGSVSPGGVKLEISTKEVPVVHTETKTITYESSQVDAGADLEPGVL
MSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQ
HPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences E2RHR2
ENSCAFP00000027414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]