SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027426 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027426
Domain Number 1 Region: 50-149
Classification Level Classification E-value
Superfamily F-box domain 1.24e-19
Family F-box domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027426   Gene: ENSCAFG00000018584   Transcript: ENSCAFT00000029504
Sequence length 387
Comment pep:known_by_projection chromosome:CanFam3.1:4:67650121:67665658:-1 gene:ENSCAFG00000018584 transcript:ENSCAFT00000029504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEPRCGGRSPPPHHSDWSRLEAAILSGWRNFWQSVGKERAAPRASQEEAGEEASALT
RLPIDVQLYILSFLSPYDLCQLGSTSHYWNETVRDPILWRYFLLRDLPSWPSVDWKSLPD
LEILKKPISEVTDGAFFDYMAIYKMCCPYTRRSLKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVSFQLSNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSLQNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSRIMAMTDPAFGSSGRPMLVLSCISQANVKRMPCFYLAHELRLNHLNHPWMVQ
DTEAETLTGFLNGIQWILEEVESKHTR
Download sequence
Identical sequences E2RGX5
ENSCAFP00000027426 ENSCAFP00000027426 XP_003639033.1.84170 9615.ENSCAFP00000027426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]