SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027482 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027482
Domain Number 1 Region: 47-195
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-39
Family Phosphotyrosine-binding domain (PTB) 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027482   Gene: ENSCAFG00000018622   Transcript: ENSCAFT00000029566
Sequence length 811
Comment pep:known_by_projection chromosome:CanFam3.1:4:69625928:69644979:1 gene:ENSCAFG00000018622 transcript:ENSCAFT00000029566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCLLVLEFAVCLLAMSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGD
GVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIID
EKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVIDLKDLF
QVIYNVKKKEEEKKKMEEANKAVENGSETLLTLDDQANKLKLGVDQMDLFGDMSTPPDLN
SPTESKDILLVDLNSEIDTNQNPLRENPFLTNGITSCSLPRPKPQASFLPENAFSANLNF
FPTPNPDPFRDDPFAQPDQSTPSSFDSLKSSDQKKENLSSLSTPLSNGPLNGDVDYFGQQ
FDQISHRTGKQEAQAGPWPFASTQTQPTVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGL
SVLNGVKQDLESSVQSSPHDSIAIIPPPQSSKPGRGRRTAKSPAKDLLASDIFTPPVSEP
PGQSATLQTNPLDLFKTSASTPVGPLAGLGSLQCFSASVFGHGTQTSGGGIPVGPPQSTS
VVPGAMMSGQPSGFGQPVVFTTSPAVPGWNQPSSFAASTSPPAPVVWGPSASMAPNTWSS
TSPLGNPFQSNIFPASAVSTQSPSMLSSLLVAPPQPPPRTGPPKDISSDAFTALDPLGDK
EVKEVKEMFKDFQLRQPPAVPARKGEQTSSGTSSAFSSYFNSKVGIPQENADHDDFDANQ
LLKKINEPPKPAPRQGSLPVTKSADNTFENPFSKDSFSSSQASKISFVSHFAWLTKAFWE
KTDNKYASQIIKASQPTSSDVYRDPFGNPFA
Download sequence
Identical sequences E2RFW4
ENSCAFP00000042320 ENSCAFP00000027482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]