SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027597 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027597
Domain Number 1 Region: 255-326
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.01e-17
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 161-242
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000971
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027597   Gene: ENSCAFG00000018703   Transcript: ENSCAFT00000029692
Sequence length 361
Comment pep:known_by_projection chromosome:CanFam3.1:X:100989831:101001831:1 gene:ENSCAFG00000018703 transcript:ENSCAFT00000029692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKPSNASEKEPTQKRKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSSVP
TTEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTLEEGSASPTSPDCSLDS
PSPEKMALAFSEQEEHELPALSRQASTACCGQQFSCSELCSPSPGSGSFGEEPPAPQYTG
PFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGRLGSFKFIYVDVL
PEEAAGPARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHL
NELNITDPQHRAKLLTAAELLLDYDSEWAQEEDVGVPAAKVDIPRDSGCFEGSESGRDEA
E
Download sequence
Identical sequences E2QUU9
ENSCAFP00000027597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]