SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027603 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027603
Domain Number 1 Region: 187-368
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027603   Gene: ENSCAFG00000018707   Transcript: ENSCAFT00000029699
Sequence length 646
Comment pep:known_by_projection chromosome:CanFam3.1:7:75488126:75510209:1 gene:ENSCAFG00000018707 transcript:ENSCAFT00000029699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDI
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGVPLTDAAERTMLYDGIRLPAVFRECVDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRSTESEKV
QEFQRLLKELPECNYLLISWLIVHMDHVISKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVEELFGNVVLKQVTKPLRWSNMATMPTLPETQENIKEEIRRQEFLLNCLHRDLQAGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQIILEDLQRQNEELEIKNNHLNQAVHEEREAIIELRVQLRLLQLQRAR
PEPQGQDDDEPPRDGALEVKAAKEQPKAGKEQAKPSPSRDRKETPI
Download sequence
Identical sequences E2R651
ENSCAFP00000027603 9615.ENSCAFP00000027603 XP_005623140.1.84170 XP_547670.1.84170 ENSCAFP00000027603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]