SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027650 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027650
Domain Number 1 Region: 375-505
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-36
Family Ran-binding domain 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027650   Gene: ENSCAFG00000018739   Transcript: ENSCAFT00000029752
Sequence length 557
Comment pep:known_by_projection chromosome:CanFam3.1:20:54122903:54174765:1 gene:ENSCAFG00000018739 transcript:ENSCAFT00000029752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKSSAEQKDLSDSGEEPRGEAEAPHHGTGHPESAGE
HALEPPAPASASASTPEAQLLPFPRELAGRSAGGSEATGPVDSDREDGNYCPPVKRERTS
SLTQFPPSQSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKAL
SQTVPSSGTNGVSIPADCTGAMTATSPDNPARRSPSDEVRALEEKEPQKNESSDTCEEEN
CEKREQVAQQAFVFGQNLRDRVKLTNENTEVADMENAGHPSSETPTATNYFLQYISSSLD
NSTNSADTASNKFVFGQNMSERVLSPPKLNEVSSDATRENAAAESGSESSSQEATPEKES
LAESAAAYTKATARKCLLEKVEVITGEEAESNVLQIQCKLFVFDKASQSWVERGRGLLRL
NDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVF
LISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEDDSDEDVLAPSGA
TGGGASEEGDGQTAGST
Download sequence
Identical sequences F1PS48
ENSCAFP00000027650 ENSCAFP00000027650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]