SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027693 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027693
Domain Number 1 Region: 348-467,517-756
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 5.62e-60
Family Tex N-terminal region-like 0.008
Further Details:      
 
Domain Number 2 Region: 777-931
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-23
Family Tex RuvX-like domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 946-1038
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000289
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 
Domain Number 4 Region: 1326-1417
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000249
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1227-1284
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1051-1139
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027693   Gene: ENSCAFG00000018763   Transcript: ENSCAFT00000029797
Sequence length 1726
Comment pep:known_by_projection chromosome:CanFam3.1:9:42871584:42895425:1 gene:ENSCAFG00000018763 transcript:ENSCAFT00000029797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFIND
DDDEDEGEEDEGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
VKKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAVEAPMAPPEEEEEDDEESD
IDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEY
EYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQL
RSIPVKGAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPTSSFSRKGPSTIQKIK
EALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQN
AAKASRKKLKRVREEGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFG
LTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREP
LVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKICLAE
DEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQF
LYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIR
VLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFL
LNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSVGVELVDNELAILYMNSKKSE
AEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYC
EFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTM
CHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESA
EDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTA
YRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPF
CQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVG
MTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQ
QRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQH
VDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDR
KKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQI
FPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMT
SQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPS
YSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQ
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences E2R4A3
9615.ENSCAFP00000027693 ENSCAFP00000027693 XP_013972259.1.84170 XP_537747.2.84170 ENSCAFP00000027693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]