SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027899 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027899
Domain Number 1 Region: 37-138
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-23
Family SH2 domain 0.00028
Further Details:      
 
Domain Number 2 Region: 131-176
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000131
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027899   Gene: ENSCAFG00000018916   Transcript: ENSCAFT00000030021
Sequence length 177
Comment pep:known_by_projection chromosome:CanFam3.1:6:31511024:31511557:1 gene:ENSCAFG00000018916 transcript:ENSCAFT00000030021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPAAPTPAPAPAAAPGDTHFRTFRSQAEYRRITRASALLEACGFYWGPLNVHGAHERLR
AEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHY
VAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences F1PLC4
ENSCAFP00000027899 ENSCAFP00000027899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]