SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027900 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027900
Domain Number 1 Region: 173-518,597-621
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.21e-84
Family Myotubularin-like phosphatases 0.0000454
Further Details:      
 
Domain Number 2 Region: 16-159
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000258
Family TFIIH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027900   Gene: ENSCAFG00000018909   Transcript: ENSCAFT00000030022
Sequence length 720
Comment pep:known_by_projection chromosome:CanFam3.1:4:75176995:75217730:1 gene:ENSCAFG00000018909 transcript:ENSCAFT00000030022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIHANEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQRGIYGKLVCTDFKIAFLGD
DESALDNDEAQFKNKVIGENDITLHCVDQIYGVFDEKKKPLFGQLKKYPEKLIIHCKDLR
VFHFGLRYTKEEEVKRIVSGIIHHTQAPKLLKRLFLFSYAAAAQNNTATDPKNHTVMFDT
LKDWCWELERTKGNVKYKAVSVNEGYKVCVRLPAYFVVPISLPEEDVLRFQGHGIPIWCW
SCHNGCALLKMSALPKEQDDGSLQIQKSFLDGIYKTIHRPPYEIVKTEDLSTNFLSLQDI
QTAYSKFKQLFLIDNSTEFWDTDIKWFSLLENSSWLDIIRRCLKKAIEIAECLEAQNMNV
LLLEENASDLCCLISSLVQVMMDPHCRTRVGFQSLVQKEWIMGGHCFLDRCNHLRQSDKE
EVPVFLLFLDCVWQLVHQHPPAFDFTETYLTVLSDSLYLPIFSTFFFNSPHQKDINMGRE
HQDTQSKPLNLLTVWDWSVQFEPKAQMLLKNPLYVEKPKLDKGQRKGMRFKHQRQLSLPL
TQSKSSPKRGFFREETDHLIKNLLGKRISKLINSSDELQDNFREFYDSWHSKPTDYHGLL
LPHIEGPEIKVWAQRYLRWIPEAQILGGGRVATMSKLLEMMEEVERLQEKIEERHHSQGA
LPAEGPSLLRSSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences F1PKG8
ENSCAFP00000027900 9615.ENSCAFP00000027900 ENSCAFP00000027900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]