SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027929 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027929
Domain Number 1 Region: 29-173
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-40
Family Phosphotyrosine-binding domain (PTB) 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027929   Gene: ENSCAFG00000018929   Transcript: ENSCAFT00000030052
Sequence length 588
Comment pep:known_by_projection chromosome:CanFam3.1:5:52231277:52491272:1 gene:ENSCAFG00000018929 transcript:ENSCAFT00000030052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKL
CQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDI
TDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQC
EQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPV
SNGQPFEDFEERFAAATPVRIFPCGDFIIFVSFQAVTQLELFGDMSTPPDITSPPTPATP
GDAFIPSSSQTLPASADMFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQP
PVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPL
ATVPTTGDSTRSSPQTEKPRQKMGKEMFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYF
NKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDD
IFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS
Download sequence
Identical sequences E2R207
ENSCAFP00000027929 ENSCAFP00000027936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]