SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028038 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028038
Domain Number 1 Region: 566-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-54
Family DBL homology domain (DH-domain) 0.000000158
Further Details:      
 
Domain Number 2 Region: 761-889
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-35
Family Pleckstrin-homology domain (PH domain) 0.0000127
Further Details:      
 
Domain Number 3 Region: 250-396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000576
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 4 Region: 52-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000916
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028038   Gene: ENSCAFG00000019001   Transcript: ENSCAFT00000030173
Sequence length 966
Comment pep:known_by_projection chromosome:CanFam3.1:X:109556994:109627261:-1 gene:ENSCAFG00000019001 transcript:ENSCAFT00000030173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETELLLRAKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCVPEEVIAKVLTYLTSI
ARQNGSDSRFTIILDRRLATWSSLKISLQKISVSFPGNLHLVLVLRPTSFLQRTFTDIGF
RFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTV
KEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHMLKNDITAVTKEGKILLTSLEV
PGIEDAASSRLEHHHQINGDWQTVNKLLTQVHDMEIAFDGFWEKHQLKMEQYLQLWKFEQ
DFQELVSEVELMLNQQAELADITGNIGQVKQKIKKLENLDENSQDLLAKARFVILHGHRL
AANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRIFKMHKLLQQARQCCDEGECLL
ANQEIDKFQSKEDAQKALRDIENFLEMALPFINYDPDTLQYEFDVILSPELKVQMQTVQL
KLEHIRSVFENQQAGFRNLTDKHVKPVQFVVPASDNLIRSRTSLFSPKHGKKTWRQNQSN
LKIEVVHDCREKRSSGQSSSLDNDNSLDVLQNHVLNELIQTERVYVRELFTVLLGYRAEM
DNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNNIFLNSLEDCVDAPERVGPCFLERKDNF
QMYAKYCQNKPRSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKEL
LKYSKGCPGFEQLKEALDTMLDLLKSVNDSMHQIAINGYIGNLNELGKMVMQGAFSVWIG
HKKGATKMKDFARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCLKMDEVGI
TEYVKGDNRKFEIWYAGKEEVYIVQAPNVDVKMTWLKEIRSILLKQQELMTVKKRKQHNP
LMEQDQLSSQQNEISLLQSSGFCMYRRQCHDQGAEETESEHSGTMVEVREAIASVQAEAN
TGMCNG
Download sequence
Identical sequences F1PX82
ENSCAFP00000028038 ENSCAFP00000043201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]