SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028171 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028171
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-23
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000996
Family SH2 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028171   Gene: ENSCAFG00000019095   Transcript: ENSCAFT00000030322
Sequence length 411
Comment pep:known_by_projection chromosome:CanFam3.1:20:55325308:55333664:1 gene:ENSCAFG00000019095 transcript:ENSCAFT00000030322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALSPPRGPKGKGALPSHYYESFLEKKGPHDQDYKKFWAGLQGCTLYFYNSNRDSQHV
EKLGLGAFVRLSDEAPGGSPRDPGIYFSLVLWNQEIKFKVESLESREMWKGFILTVVELR
VPSNLTLLPGHLYMMAEALAKEEARRALEVPPCFLRVSRLEAQLLLERYPECGNLLLRPS
GDGADDVSVTTRQTLHGTPVFRHYKVKRDGSKYVIDVEDPLSCASLDAVVNYFVSNTNRR
LVPFRLDEDYEKVLGHVEADKENGESVWVASSAPVAPGPGPAPASGGCKQLPPVPITPPP
SQDKPPLLLNQNENYVIPIADAPAADYENEDVPSPSWQVVPKPRKLAKSLKPPIAPKPEP
KGVNSGLAKKLAVGSVQALFPTTGLADLTAELEEKLQRRRALEHSAGCAGE
Download sequence
Identical sequences E2R1E5
ENSCAFP00000028171 ENSCAFP00000028171 XP_542159.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]