SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028195 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028195
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-27
Family SH2 domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028195   Gene: ENSCAFG00000019109   Transcript: ENSCAFT00000030348
Sequence length 340
Comment pep:known_by_projection chromosome:CanFam3.1:20:55356178:55361655:-1 gene:ENSCAFG00000019109 transcript:ENSCAFT00000030348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYREQKDLDFEDPYEDSDSRLEPDPAGP
GDCKGPGDAKYDSPKHRLIKVEAADMARAKVLLGGPGEELELDTEYSDPFDAQPHPPPSD
DGYMEPYDAQRAVSDLPCKGVQLYDTPYEEQDQDPGDGAPSGRRPRQSRLPQEDERPADE
YDQPWEWKKDHISKAFAVQFDSPEWERTPGSAKELRRPPSRSPQAAERVDPALPLEKQPW
FHGPLSRADAENLLSLCKAGSYLVRLSETSPQDCSLSLRSSQGFLHLKFARTRESQFVLG
QHSGPFASVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
Download sequence
Identical sequences F1Q2R8
XP_003432848.2.84170 ENSCAFP00000028195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]