SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028221 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028221
Domain Number 1 Region: 210-594
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-159
Family Myotubularin-like phosphatases 0.0000000000287
Further Details:      
 
Domain Number 2 Region: 86-206
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-41
Family GRAM domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028221   Gene: ENSCAFG00000019125   Transcript: ENSCAFT00000030374
Sequence length 654
Comment pep:known_by_projection chromosome:CanFam3.1:X:118820517:118917184:1 gene:ENSCAFG00000019125 transcript:ENSCAFT00000030374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRQPARGGGRRAVARGGAAAGGGPWRGRSGAREASSLATAVAPGPRVSSMASAPTSKY
NSHSLENESIKRTSRDGVNWDLSEAVPRLPGETRITDKEVIYICPFNGPIKGRVYITNYR
LYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLRFALKQEGHS
RRDMFEILTRYAFPLAHSLPIFAFLNEEKFNVDGWTVYNPVEEYRRQGLPNHHWRITFIN
KCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGM
SGKRNKDDEKYLDVIRETNRQISKLTIYDARPNVNAVANKATGGGYESDDAYHNAELFFL
DIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQVADRVSSGKS
SVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFASRIGHGDKNH
ADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLITILDHLYSCRFGTFLYNCESAREKQ
KVTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQ
PNPVEQRYVELLALRDEYIQRLEELQLASSAKLPDPSTSPAGPSQMMPHVRTHF
Download sequence
Identical sequences F1Q1K0
ENSCAFP00000028221 ENSCAFP00000028221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]