SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028375 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028375
Domain Number 1 Region: 74-436
Classification Level Classification E-value
Superfamily Serpins 5.5e-97
Family Serpins 0.00000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028375   Gene: ENSCAFG00000019240   Transcript: ENSCAFT00000030538
Sequence length 491
Comment pep:known_by_projection chromosome:CanFam3.1:9:45876114:45883941:1 gene:ENSCAFG00000019240 transcript:ENSCAFT00000030538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLRGLLVISLSCLQGSGAVFPPASAMEPLDQQLMGGQTQEKLPPLTLLKLGNQESSGH
IGLKKAPRDCRGAPTPEQTRRLAQAMMAFTTDLFSLVAQRSTSPNLILSPLSVALALSHL
ALGAQNQTLRRLEQVLHADSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLK
QSEQLFGAKPMSLTGRKGDDLLNINQWVKEATEGKIEDFLSELPDDTVLLLLNAIHFQGF
WRSKFDPSLTQRDSFHLNEQFTVPVDMMHARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
IMPTHFEWNVSQVLANLSWDILHQPLLREKPTKVRLPKLHLNYQLDLVATLSRLGLQELF
QAPDLRGISDQRLVVTSVQHQSALELSEAGVEAAAATGTAMSRMSLSSFSVNRPFLFFIL
EDTTSLPLFVGSVKNPNPSAPWERKEQQDSPDDRDYFQNRKAFPRGDKPFGPDLKLAPPS
EEDYPQLHSPK
Download sequence
Identical sequences E2R4V3
XP_854003.1.84170 ENSCAFP00000028375 ENSCAFP00000028375 9615.ENSCAFP00000028375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]