SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028380 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028380
Domain Number 1 Region: 41-415
Classification Level Classification E-value
Superfamily Serpins 9.3e-98
Family Serpins 0.0000000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028380   Gene: ENSCAFG00000024189   Transcript: ENSCAFT00000030543
Sequence length 418
Comment pep:known_by_projection chromosome:CanFam3.1:9:45891048:45902636:1 gene:ENSCAFG00000024189 transcript:ENSCAFT00000030543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALVLLLWTGALLGHSSCQNDAGGPQEDSPAPDATGVPVEEEDPFFRVPVNKLAAAISN
FGYDLYRVRSSFSPAANVLLSPLSVATALSALSLGAEQRTESTIHRALYYDLISNPDIHS
TYKELLASVTAPEKNFKSASRIVFERKLRIKSSFVAPLEKSYSTRPRILTGNPRLDLQEV
NNWVQAQMKGKIARSTREIPSGISILLLGVAYFKGQWVTKFDSRKTSLEDFHLDEERTVK
VPMMSDPKAILRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTMIEESLTSEFIHD
IDRELKTIQAVLTIPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA
GFEWNEDGAGTTPSPGLQPTRLTFPLDYHLNRPFIFVLRDTDTGALLFIGKILDPRGI
Download sequence
Identical sequences F2Z4Q7
XP_005624419.1.84170 ENSCAFP00000028380 ENSCAFP00000028380 9615.ENSCAFP00000028380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]