SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028484 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028484
Domain Number 1 Region: 2-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.34e-83
Family BAR domain 0.00043
Further Details:      
 
Domain Number 2 Region: 404-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.09e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.0002
Further Details:      
 
Domain Number 3 Region: 671-787
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.93e-25
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 263-367
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-23
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028484   Gene: ENSCAFG00000019294   Transcript: ENSCAFT00000030647
Sequence length 833
Comment pep:known_by_projection chromosome:CanFam3.1:5:56468164:56481913:-1 gene:ENSCAFG00000019294 transcript:ENSCAFT00000030647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECIKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSSMIEAGKAYVTTNRLFVSG
VRDLSQQCQGDSVISECLQRFGDSLQEMVNYHMILFDQAQRSVRQQLHNFVKEDVRKFKE
TKKQFDKVREDMELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQYSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKRDMERKH
AAIQQRTLLQDFSYDEPKVEFDVDAPRRVVMEGYLFQRASNAFKTWNRALFSIQNSQLVY
QKKLKDVLTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDSRERSVKGESVLQRVQNVAGNSQCGD
CGQLDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTMN
QIYEAQCEGPGSKKPTASSPRQDKEAWIKDKYVEKKFLRKPPSAPAREAPRHWRVQKCQR
HHSSPRAPAARRKVRLEPVLPSVAALSSAGAGERKFRRDSLFCPDELDSLFSYFDAGAAA
AGPRSLSSDSGLGGSSDGSSDVLAFSTGSVVDSVTEEEGAESEESSGEADGEAEAWGLAD
VRELHPGLLAHRAARTRDLPALAAALAHGAEVNWADTEDEGKTPLVQAVLGGSLIVCEFL
LQNGADVNQKDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDHEQQDPLSIAVQEANA
DIVTLLRLARMAEEMREAEAPPGQPGALLGTSPTELQYRRCIQEFISLHLEES
Download sequence
Identical sequences E2QY37
ENSCAFP00000028484 ENSCAFP00000028484 9615.ENSCAFP00000028484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]