SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028622 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028622
Domain Number 1 Region: 298-404
Classification Level Classification E-value
Superfamily Cyclin-like 9.97e-27
Family Cyclin 0.001
Further Details:      
 
Domain Number 2 Region: 407-529
Classification Level Classification E-value
Superfamily Cyclin-like 1.66e-25
Family Cyclin 0.0035
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily F-box domain 0.00000000615
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028622   Gene: ENSCAFG00000019372   Transcript: ENSCAFT00000030788
Sequence length 783
Comment pep:known_by_projection chromosome:CanFam3.1:6:38574239:38592435:-1 gene:ENSCAFG00000019372 transcript:ENSCAFT00000030788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGVIHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVGDILAVRAVHS
HLKYLVDNHASVWACASFQELWPSPRNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLKASRFFSLAERLNVGATPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQG
THRASLLHCLGRVLSLFEDEERKQQAQDLFEESANQGCLVSSYLLWERDRRTDMSDPGRC
LYSFRKLRDYAAKGCWEAQLSLAKACAHGSQLGLEAKASDAVVRQLFQTSRAVGKQQVFS
VQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALEGKIRVPTVVDYKDVLLTL
VPVAPRTQHLCSFLCELSLLHTSLAVYAPARLAAAALLLARLTHGQTQPWTTRLWDLTGF
SSEDLIPCVLSLHQKCFHDDAPKDYRQVSLTAVKQRFEDKRYEEISQEEVLSYGQLCAAL
GVKQGSPEPASFLNTGDIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEEML
LGSFLDWSLDYCSGYEGDQESEGEKDGDVTAPSGILDVTVVYLSPEQHCCQESSDEEACP
EDRGHQDPRTWVPGPQMPPTPEPEPQLCGTRKPGRDSVTSGYSSISSASPTNSVDGVSGG
PPQSTSVPSPGSDLNTQFCHHHAKKSCLQCRSPGPLESSVPQVKRKSLCTHSEEEEEGDV
SQA
Download sequence
Identical sequences F1Q1Q2
ENSCAFP00000028622 ENSCAFP00000028622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]