SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028726 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028726
Domain Number 1 Region: 76-362
Classification Level Classification E-value
Superfamily Kelch motif 4.84e-45
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 1840-2019
Classification Level Classification E-value
Superfamily Fibronectin type III 6.59e-19
Family Fibronectin type III 0.000033
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000028726
Domain Number - Region: 362-410
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00107
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028726   Gene: ENSCAFG00000019428   Transcript: ENSCAFT00000030892
Sequence length 2067
Comment pep:known_by_projection chromosome:CanFam3.1:X:121790496:121814310:-1 gene:ENSCAFG00000019428 transcript:ENSCAFT00000030892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVSPANSPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIETL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSV
PANPPKSPAPAAAAPAVQPLTQVGITLLPQAATAPPTTTTIQVLPTVPGSSISVPAAART
QGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSS
PQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTVAVTPGTTTLPATVKVASSPV
MVSNPATRMLKTAAAQVGTSVSSAANTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKT
ITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGT
ILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQ
AGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPG
QPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGH
STSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQV
TLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGEVQPGTVTLVCSNPPCET
HETGTTNTATTTVVANLGGQPQPTQVQFVCDRQEAAASLVTSTVGPQNGSVVRVCSNPPC
ETHETGTTHTATTATSNMAGQHSCSNPPCETHETGTTSTATTAMSSIGTNPQPDARRAYV
AGSTPAVVRIGVAPGASEGAQGFVKPLCQTRQTSVTSTTMTVMATGAPCSAGPLLGPGLA
VESGGRGTTFVQLAPVSGQVRPSVPGGKDTPVASLSQLVSVGRQLEAHHTHTTNTPTTVR
STMGSGEPSEARGTPMPAYESSPGPAVTVTALEALLCPSATVTQVCSNPPCETHETGTTN
TATTSNAGSTQRVCSNPPCETHETGTTHTPTTATSSGGAGQPEGGQQPPAGRPCETHQTT
STGTTMSVSVGALLPDTVPSHRTLESGLEVAAPPTITPQAGASLLAPFPTQRVCSNPPCE
THETGTTHTATTVTSNMSSNQDPPPAASDQGEVESTQGDSVNITSSSAVTTTVSSTLTRA
VTTVTQSTPVPGPSVPPPEELQASPGPRQQLPPRQLLQPASTPLMGESAEVLSASQTPEL
QAAVDLSSTGDPSSGQEPTSSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLM
VTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMAGTGEPMDTSEAAAAV
TQAELGHLSAEGQEGQATTIPIVLTQQELAALVQQQQQLQEAQAQQQHHHLPTEALAPAD
SLNDPTIESNCLNELAAAVPSTVALLPSTGTESLAPSNTFVAPQPVVVASPAKLQAAATL
TEVANGIESLGVKPDLPPPPSKAPVKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDD
SGTVPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISK
SPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGGEPKSSTPAQLAFMRVYCGPSPSCLV
QSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGAKPASKRPMSSP
EMKSAPKKSKADVPSTGSRASPELRGP
Download sequence
Identical sequences E2QXV1
ENSCAFP00000028726 ENSCAFP00000028726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]