SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028783 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028783
Domain Number 1 Region: 76-214
Classification Level Classification E-value
Superfamily PX domain 4.45e-27
Family PX domain 0.00058
Further Details:      
 
Domain Number 2 Region: 303-360
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000263
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 224-294
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000158
Family SH3-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028783   Gene: ENSCAFG00000019462   Transcript: ENSCAFT00000030949
Sequence length 432
Comment pep:known_by_projection chromosome:CanFam3.1:6:38953777:38956001:1 gene:ENSCAFG00000019462 transcript:ENSCAFT00000030949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCVPVPLGGSALGTVRKLGETQGQGGGAPGEFQSSSGSLGALPPGELQAVGPLVAAGQFQ
KPRTASCEAAMAGSRHPVSVRAAALVQTGRLQTFAFSVCWSDGSDTFVRRSWAEFKELHK
TLKEAFPVEAGLLRRSDRILPKLPGEAAADTSLLVRGGRTGRGLARLRLLDTYTRALLAA
AEQLSRSAVLTGFFEPQPVDLEPVLPPGSLVILPTPEEPHRRPPHSPAICSLEAQSLRCL
QPFSTQDTQGWPFHARAQEVIDVLLRHPSGWWLVANEEQQMAWFPAPYLEEAAPDREGTT
LRSSGSQFCASQAYESSHADELSVPAGARVSVLETSDRGWWLCRFRGRSGLLPAVLLQPE
GLGALLSGPGLHREANSKEDRGGEAQRTPEACQATTLSPSVPARPPLSAIRSRCCSVTRR
ALASKYPPRAGQ
Download sequence
Identical sequences E2QWZ5
ENSCAFP00000028783 ENSCAFP00000028783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]