SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028797 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028797
Domain Number 1 Region: 292-512
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-56
Family DBL homology domain (DH-domain) 0.0000738
Further Details:      
 
Domain Number 2 Region: 502-642
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 655-715
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000708
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028797   Gene: ENSCAFG00000019474   Transcript: ENSCAFT00000030963
Sequence length 735
Comment pep:known_by_projection chromosome:CanFam3.1:5:58038435:58051936:1 gene:ENSCAFG00000019474 transcript:ENSCAFT00000030963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRGPGADPTWICRPPGHWPVSMSQRHSDSSLEEKLLEYRFHSELRLDAKGNPASGLPM
VRGSLQVVRDNAPFQVDTSGPPPLSPKDQESRTVILSTQSPAALKMGTQQLIPRSLAVSS
KAKTPARHQSFGAAVLSKEAARRDPQLLSAPSFSLDDMDVDMGSEGALRRNLRNRSYRAA
MKGLGAPSGDRGPSQLSPKLQALAEEPSQPSARGPAKNKFAQKTLGRKRAHKGSFKDDPG
FYQEIRERGLNTSHESDDDMLDEPPSPDGTGRADAPIVVKSYRPAQITWSQLPEVVESGL
LDTLPPEERKRQEAIFEILTSEFSYQHSLSILVAEFLHSRQLRATMTQTEHHHLFSNILD
VLSASQRFFEDLEQRHKAQVCVEDISDILEEHAEKHFHPYVVYCSNEVYQQRALQKLTSS
NAAFHEALKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKSQGHPERYKAASRA
LKAISKLVRQCNEGAHKMERTEQMYTLHTQLDFGKVKSLPLISASRWLLKRGELFVVEET
GIFRKLASRPTCYLFLFNDVLVITKKKSEDSFLVQDYAQVDHIRVQKMEPSDPSLVGGSS
RSSLVPHVFQVTMLHNSEGRQEKILLSSDSASDRARWITALTHRERQGRGPTNKGDLLQV
EVTKAYLAKQADEITLQQADVVLVLEQEDGWFYGERLRDGEMGWFPEDFARCITSRVAVE
GNVRRMERLRVETGV
Download sequence
Identical sequences F1Q028
XP_005620490.1.84170 XP_005620491.1.84170 XP_005620492.1.84170 XP_013969349.1.84170 ENSCAFP00000028797 ENSCAFP00000028797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]