SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029029 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029029
Domain Number 1 Region: 197-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-52
Family Nucleotide and nucleoside kinases 0.0000054
Further Details:      
 
Domain Number 2 Region: 56-188
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-33
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-18
Family PDZ domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029029   Gene: ENSCAFG00000019627   Transcript: ENSCAFT00000031197
Sequence length 385
Comment pep:known chromosome:CanFam3.1:X:122852116:122866103:-1 gene:ENSCAFG00000019627 transcript:ENSCAFT00000031197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETK
GMISLKVIPNQQNRLPALQMFMRAQFDYDPRKDHLIPCKEAGLKFVTGDIIKIINKDDSN
WWQGRVEGSSKESAGLIPSPELQEWRVASAAQSAPSEAPSCSPFGKKKKYKDKYLAKHSS
IFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALLTQNPDKFAYPAPYTTRPP
KKGEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHEQDKIAILDIE
PQTLKIVRTAELSPFIVFIAPTDQGAQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVEE
TLTKLQEAFEQACSSPQWVPVSWVY
Download sequence
Identical sequences F1PFU5
ENSCAFP00000029029 ENSCAFP00000029029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]