SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029189 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029189
Domain Number 1 Region: 131-315
Classification Level Classification E-value
Superfamily PH domain-like 2e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000174
Further Details:      
 
Domain Number 2 Region: 474-581
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029189   Gene: ENSCAFG00000019711   Transcript: ENSCAFT00000031361
Sequence length 593
Comment pep:known_by_projection chromosome:CanFam3.1:20:58001448:58021323:1 gene:ENSCAFG00000019711 transcript:ENSCAFT00000031361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQGPGGRTPPAPPAPPEPEAPTTFCALLPRMPEWKFAAPAGFLGRGPAAARTAGGAGGA
GGAGGAGGADPQPEEAAPGGVPALAAAVLGACEPRCAAPCPLPALSRCRAAGARGPRGAR
GGAGPPDAAAAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLD
FNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISTDGL
NLSVPATRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSII
STVGQAFELRFKQYLHSPPRVAVPPERLTRPEESAWGDEDEADHNYYNSIPGKEPPPGGL
VDSRLALAQPGALGALGQGAAPARRDARSLPWDLGPSGAGPPGDGYVQADARGPRDYEDH
LYVNTQGLDAPEPPQAEDSPKKDLFDMRPFEDALKLHECSAGAGTAVAPLPVEDQWPSPP
TRRAPIAPTEEQLRQEPWYHGQMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQP
KHLLLVDPEGVVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
Download sequence
Identical sequences F1PA45
ENSCAFP00000029189 XP_013977736.1.84170 XP_013977737.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]