SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029295 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029295
Domain Number 1 Region: 5-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.82e-132
Family Motor proteins 0.0000000000211
Further Details:      
 
Domain Number 2 Region: 530-635
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.71e-28
Family FHA domain 0.00000836
Further Details:      
 
Domain Number 3 Region: 1603-1659,1697-1794
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029295   Gene: ENSCAFG00000019785   Transcript: ENSCAFT00000031471
Sequence length 1815
Comment pep:known_by_projection chromosome:CanFam3.1:5:63383787:63512028:1 gene:ENSCAFG00000019785 transcript:ENSCAFT00000031471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGHLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDTETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVC
IEDPNAKLRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGGKYLKDFQNNKHRYLL
ASENQRPGNFSTASMGSLTSSPSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKESE
KIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDP
LMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIQEEHCIFRSERNNSGDVIVTLEPCE
RSETYVNGKRVAQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTF
AQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVETR
SLAAETTEEEEEEEEAPWTQHEFELAHWAFRKWKSHQFTSLRDLLWGNAVYLKEANAISV
ELKKKVQFQFVLLTDTLYSPLPPELLPAEMEKTHEDKPFPRTVVAVEVQDLKNGATHYWS
LEKLKQRLDLMREMYDRAGEMASGAQDDGEATVTGSDPFYDRFHWFKLVGSSPIFHGCVN
ERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDTGSDAGTEEGSDLFSDGHD
PFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAPD
YGSGIRQSGTAKISFDNEYFNQNDFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEIN
RMNDLDLKSGTLLDGKMVMEGFSEEVGNHLKLGSAFTFRVTVLQASGILPEYADIFCQFN
FLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPIVFEVFGHYQQHP
LHLQGQELNSPPQPSRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISEL
EPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRN
KAEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKI
YMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGI
YELSLCKMADTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLEL
LHEVEKTRHFLLLRDRLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPS
ESSGYDSADIESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKLSDISPIGRDPSV
SSFSSATLTPSSTCPSLVEARSNSLDQKTPEANSRASSPCTEFEQFQIVPTVETPYLARA
GKNEFLNLVPDIEEIRPGSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVE
RGIINLSTAQVEYSEDQQAMVKTPNIFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGT
IRSKLSRRCPSESKY
Download sequence
Identical sequences E2R9C4
ENSCAFP00000029295 9615.ENSCAFP00000029295 ENSCAFP00000029295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]