SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029326 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029326
Domain Number 1 Region: 26-149
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-38
Family Phosphotyrosine-binding domain (PTB) 0.00051
Further Details:      
 
Domain Number 2 Region: 449-527
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-19
Family SH3-domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000029326
Domain Number - Region: 533-588
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000341
Family Pointed domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029326   Gene: ENSCAFG00000019805   Transcript: ENSCAFT00000031504
Sequence length 596
Comment pep:known_by_projection chromosome:CanFam3.1:6:42167103:42176078:1 gene:ENSCAFG00000019805 transcript:ENSCAFT00000031504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSSRAIYLQRKEYLQNISSEPTCLQHRVEHLMTCKLGSQKIQEPKDALKKLQEMDAQ
GRVWSQDLFLQVRDGWFQLLDIETKEELDSYRLDSIQAMDVVLSIGSYNAILSITVQESS
LPATSTLLFHCQEVRAEQLRNSLKKALEEEQQQSRPHSRARHPSQDRWRGPSPERSFSKE
QVPPPEQGLPPEQSYWMTPEHSTPPSPRPLLRNSSTQESSTLTLPPPRRTPSPESPERDE
EILSHVLRDIELFVGKLKEAQAKSSHKKKKLGKKKGKDQWGMTQAQYIDCFQKIKYSFNL
LGKLAIWLQEKNAPEFVHILFQLLDSILAQCPEPGLAARVISPLLTPKAIDLLQSCLSPA
ESNFWKRLGAAWTTSRANWTGSEPPPYQPTFYDGWQLPEPSNQAPSGYQSSTSLRGGSPG
LGSTSYLAQEETHNHGPQPGDPNHVPSSSRPMKPALKMQVLYEFEARNPQELTVAQGEVL
EVLDQSKRWWLVKNEKGQSGYIPSNILEPLQSRAPGDQSQSPSWAPVLRPSSTPEEVAAW
LQAQNFSTTTVKSLRFLTGSQLLRMRPGELQMLCPQEAPRVLAQLENVRRTLGVRT
Download sequence
Identical sequences F1P7G1
ENSCAFP00000029326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]