SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029334 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029334
Domain Number 1 Region: 7-208
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-53
Family DBL homology domain (DH-domain) 0.00000166
Further Details:      
 
Domain Number 2 Region: 195-357
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 475-576,624-650
Classification Level Classification E-value
Superfamily SH2 domain 2.93e-25
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 4 Region: 578-652
Classification Level Classification E-value
Superfamily SH3-domain 5.71e-18
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 5 Region: 379-469
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029334   Gene: ENSCAFG00000019810   Transcript: ENSCAFT00000031512
Sequence length 656
Comment pep:known_by_projection chromosome:CanFam3.1:9:50105212:50144052:-1 gene:ENSCAFG00000019810 transcript:ENSCAFT00000031512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMGMSEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMTPLRLVLSPADMAAIFINLEDLI
KVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFR
QKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEAMQD
LAMYINEVKRDKETLKKISEFQSSIENLQVKLEEYGRPKIDGELKVRSIVNHTKQDRYLF
LFDKVVIVCKRRGYSYELKEVIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFF
CKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACRMFLRGTFYQGYL
CTKCGVGAHKECLEVTPPCKISSPADLDASGAGPGPKMVAVQNYHGNPAPPGKPVLTFQT
GDVIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSRETDYTAYPW
FAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITE
AKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERAAPRASSRSPVFTPRVIGTAV
ARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGEANGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences F1P6T3
ENSCAFP00000029334 ENSCAFP00000029334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]