SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029622 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029622
Domain Number 1 Region: 312-478,869-1045
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 8.37e-124
Family Mammalian PLC 0.00000648
Further Details:      
 
Domain Number 2 Region: 621-736
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-30
Family SH2 domain 0.000023
Further Details:      
 
Domain Number 3 Region: 528-641
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-25
Family SH2 domain 0.00049
Further Details:      
 
Domain Number 4 Region: 1062-1183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.73e-24
Family PLC-like (P variant) 0.003
Further Details:      
 
Domain Number 5 Region: 15-130
Classification Level Classification E-value
Superfamily PH domain-like 8.32e-21
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 6 Region: 766-832
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-18
Family SH3-domain 0.00025
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.0000000245
Family Calbindin D9K 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029622   Gene: ENSCAFG00000019989   Transcript: ENSCAFT00000031815
Sequence length 1265
Comment pep:known_by_projection chromosome:CanFam3.1:5:70054658:70229323:-1 gene:ENSCAFG00000019989 transcript:ENSCAFT00000031815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALAHVDSLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAN
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRARMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDQLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDTPPTELHFGEEWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTVEGGTMKYF
LTDNVMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGQHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLSVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
Download sequence
Identical sequences E2RQM0
XP_005620713.2.84170 XP_005620714.1.84170 XP_546812.3.84170 ENSCAFP00000029622 ENSCAFP00000029622 9615.ENSCAFP00000029622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]