SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029816 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029816
Domain Number 1 Region: 51-168
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 414-570
Classification Level Classification E-value
Superfamily Ras GEF 7.45e-22
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029816   Gene: ENSCAFG00000020118   Transcript: ENSCAFT00000032019
Sequence length 706
Comment pep:known_by_projection chromosome:CanFam3.1:9:55641793:55656285:1 gene:ENSCAFG00000020118 transcript:ENSCAFT00000032019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLSTYFMPGNLTSINSAKARKSSVRSAQFSKEKYILDSSPEKLHKELEEELKLSSTDL
RSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAG
ESYTHIQYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEACYGLG
QGSSKAASPASPSGPKGGHMKRRSVTMTDGLTADKVTRSSDGCPASTSLPHPRESIRNCA
LSMDQIPDLHSPMSPISESPSSPAYSTVTRVHATSAAPSATALPASPVTRRSSEPQLCPG
STPKPPGESDKGPYASPSHTLCKASPSPSLSSYSDPDSGHYCQLQPPVRGSREWAMAEAS
GRQARSYGERLKELSENGASEGDWGRAFTAPVVEATSSFNPATFQSLLIPKDNRPLEVGL
LRKVKELLAEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGRQLRL
DLLERFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDM
AQIARLEQTWVTLRQRYTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLE
CDSAPAEGPEPWGSTEHGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVF
STEFQMRLLWGSQGASSNQARRYEKFDKVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences E2RRA7
ENSCAFP00000029816 XP_005625390.1.84170 XP_013972514.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]