SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029838 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029838
Domain Number 1 Region: 68-195
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000528
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029838   Gene: ENSCAFG00000020131   Transcript: ENSCAFT00000032043
Sequence length 745
Comment pep:known_by_projection chromosome:CanFam3.1:9:55801935:55852537:1 gene:ENSCAFG00000020131 transcript:ENSCAFT00000032043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVLSTHLDDARRQHIAEKTGKILTEFLRFYEDQYGVALFHSMRHEIEATGAPQSQLLW
RKVPLDERIIFSGNLFQYQEDNKKWRNRFSLVPHNYGLVLYENKVAYERQVPPRAVINSA
GYKILTSVDQYLELVSNSLPGITSKSGSTPILKCPTQFPLILWHPSARHYYFCMMTEAEQ
DKWQAVLQDCIRHCNNGIPEASKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNL
VMEELGPELKAELAPRLKGKPQERQRQWIQISDAVYRMVYEQAKARFEAVLAKLQLARPA
MEATIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNIINEGGADKLGEYMEKLSQLAYHPLKMQSCYEKMEPLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFESLLYQELGKGPSREELCKATQRILERVLKKY
DYDSSSVRKRFFREALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWSEEYSGSGGDG
GSPGAPEAATFSEKRRRAKQVVSVVQDEEAGLPFEAGSELLSPASPDSVTELRGLLAREL
REENPLPAGPLLNGAPSSESPQPVAASEASSPPASPLWQLPPGKAADLEPPKPSDQETGE
QVSSPGDRPPIHTTTEDSAGVQTEF
Download sequence
Identical sequences E2RR68
XP_851563.1.84170 ENSCAFP00000029838 9615.ENSCAFP00000029838 ENSCAFP00000029838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]