SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029839 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029839
Domain Number 1 Region: 510-752
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-37
Family Ras GEF 0.01
Further Details:      
 
Domain Number 2 Region: 140-257
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029839   Gene: ENSCAFG00000020133   Transcript: ENSCAFT00000032044
Sequence length 816
Comment pep:known_by_projection chromosome:CanFam3.1:6:55419436:55527651:1 gene:ENSCAFG00000020133 transcript:ENSCAFT00000032044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFVNLPRNMPVNHQFPLASSMDLLSSKSPPAEHHTDAYQDVSIHGTLPRKKKGPPP
IRSCDNFSHMGTLPHSKSPRQSSPLTSAIIQEHPLQDWKGETFTFRDQHLLDPTLEYVKF
SKDRHVMDRTPERLKKELEEELLLSGEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKIHRTVLRLSEAYSRVQYQFETESFDSIPGLVRCYVGNRRP
ISQQSGAIIFQPINRTVPLRCLEERYGASPGRRPDVGKRLSLTMGGVQAREQSSPKGNLL
RNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPLGCKLSSRSPSVDTSPRPNSPVFRTG
SEPTLSPALVRRVSSDARAGEALRGSDSQLCPKPPPKPCKAPLLQPPPSPSTWLNSEANY
CELNPAFATGGDRGARPPLCAHDSYVELLTAKQNGVLGPRHSGTNYLILDDDGAGPGEAP
ATQMDQGQQEDEGEFVLPRLETASSFRPNDFESKLLPAENKPLEMAMLKRVKELFTSKDP
KAIAQHMLSTDCMVARILAVSEETRRNMGVSSGLELLTLPYGHQLRLDIIERHNTMAIGI
AVDILGCTSTLEDRAATLNRIIQVAVELKDSMGDLYSFSAIMKALEMPQITRLEKTWTAL
RHQYTQTAILYEKQLKPFSKMLHEGRESMCVPPNKISVPLLLPLVTLMERQAVTFEGTDM
WEKNDESCEIMLNHLATGRLMAETADSYRMNAERILEGFQPDEEMSEIFKTEFQMRLLWG
SKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL
Download sequence
Identical sequences E2RR67
ENSCAFP00000029839 9615.ENSCAFP00000029839 XP_005621955.1.84170 XP_005621956.1.84170 ENSCAFP00000029839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]