SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029941 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029941
Domain Number 1 Region: 273-589
Classification Level Classification E-value
Superfamily L domain-like 1.5e-45
Family Internalin LRR domain 0.05
Further Details:      
 
Domain Number 2 Region: 506-796
Classification Level Classification E-value
Superfamily L domain-like 1.5e-44
Family Leucine rich effector protein YopM 0.0071
Further Details:      
 
Domain Number 3 Region: 804-1059
Classification Level Classification E-value
Superfamily PP2C-like 1.57e-39
Family PP2C-like 0.0033
Further Details:      
 
Domain Number 4 Region: 170-267
Classification Level Classification E-value
Superfamily PH domain-like 0.00000167
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029941   Gene: ENSCAFG00000020189   Transcript: ENSCAFT00000032153
Sequence length 1348
Comment pep:known_by_projection chromosome:CanFam3.1:5:77427652:77506132:-1 gene:ENSCAFG00000020189 transcript:ENSCAFT00000032153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPRPASPLEPPEPPEAPASRRPGGIRVLKRNMKRNGSRNCLTRRSRFGSRERDWLREDV
SRGCVYLYGADTTTAATTTSASASSDLHLVLCTVETPASEICAGEGRESLYLQLHGDLVR
RLEPTERPLQIVYDYLSRLGFDDPVRIQEEATDPDLGCMLRFYGEKPCQMDHLDRILLSG
IYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKVEEVKRRQHSLA
FSSAGAQAQTYHVSFETLAECQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDIT
YLNLRHNFMQLERPGGLDTLYRFSQLKGLNLSHNKLGLFPVLLCEISTLTELNLSCNGFH
DLPSQIGSLLNLQTLCLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYGKLTMLDK
VVMAGNCLKVLNLGVLNRMSHIRHVDLRMNLLKTVVTENLEGNKYITHMDLRDNQLADLD
LSSLCSLEQLHCERNQLRELTLSGFSLRTLYASSNRLTAVNVYPVPSQLTSLELSRNLLE
CVPDWACEAKKMEVLDVSYNLLTEVPMRILSSLSLRKLTVAHNQLQSLPMLVEHIPLEVL
DIQHNLLTRLPDTLFSKALNLRYLNASANSLESLPSASAGEESLSALQLLYLTNNLLTDQ
CVPVLVGHPHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHT
LVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKT
LDTFSHITTLKIDQKPLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAVDNCAEGVGAV
YGMFDGDRNEELPRLLQCTMADVLLEEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSA
LLCYIRPDTADPASSFSLTVANVGTCQAVLCRSGKPVPLSKVFSLEQDLEEAQRVKDQKA
IITEDNKVNGVTCCTRMLGCTYLYPWILPKPHICATPLTIQDELLILGNKALWEHLSYTE
AVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGF
ASTTIIKDPPKPTTPSSSSGIASEFGSEMSTSEVSSEVGSTASDEHNTVGLDAGLLPRPE
RRCSLHPTPTSGVFQRQPSCATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCR
GRDLENSPTLTENSPTPCPEEHARGSFFGIRRQNSVNSGILLPVSKDRMELQKSPSTSCL
YGKKLSNGSIVPLEDSLNLIEVATEAPKKKTGYFAAPTQLEPEDQFVVPRDLEEEVKEQM
KQHQESRPEPEPNEEDRTELPEEFDTAL
Download sequence
Identical sequences E2RA12
XP_546844.4.84170 ENSCAFP00000029941 ENSCAFP00000029941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]