SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029978 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029978
Domain Number 1 Region: 115-210
Classification Level Classification E-value
Superfamily Cyclin-like 1.79e-47
Family Transcription factor IIB (TFIIB), core domain 0.0000087
Further Details:      
 
Domain Number 2 Region: 209-315
Classification Level Classification E-value
Superfamily Cyclin-like 8.92e-33
Family Transcription factor IIB (TFIIB), core domain 0.00000165
Further Details:      
 
Domain Number 3 Region: 9-58
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.76e-16
Family Transcriptional factor domain 0.00011
Further Details:      
 
Domain Number 4 Region: 27-78
Classification Level Classification E-value
Superfamily PDB 0.0000022
Family PDB 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029978   Gene: ENSCAFG00000020209   Transcript: ENSCAFT00000032192
Sequence length 316
Comment pep:known_by_projection chromosome:CanFam3.1:6:59492126:59527278:1 gene:ENSCAFG00000020209 transcript:ENSCAFT00000032192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL
Download sequence
Identical sequences A0A096N3D1 A0A0D9S6T9 A0A1U7TA01 A0A2J8SKU9 A0A2K5DX77 A0A2K5JTC8 A0A2K5QFE8 A0A2K5YRX0 A0A2K6NPI1 A0A2K6SSG5 E2RPG1 F2Z4J6 F2Z5J6 F6XPV5 G3RWT5 G3TV45 H0WSS0 H9Z849 K7DSH3 K9KEN4 M3W519 M3Y0A9 Q00403 Q4R3J5 Q5R886 W6FIM3
ENSTTRP00000011289 ENSOGAP00000005144 ENSCJAP00000013920 ENSCAFP00000029978 ENSCJAP00000013916 NP_001126175.1.23681 NP_001253799.1.72884 NP_001296238.1.31192 NP_001505.1.87134 NP_001505.1.92137 XP_001147170.2.37143 XP_001929441.3.46622 XP_002751091.1.60252 XP_002917714.1.58354 XP_003411247.1.64505 XP_003784220.1.62490 XP_003808436.1.60992 XP_004002218.1.66739 XP_004026141.1.27298 XP_004263050.1.21590 XP_004326593.1.83887 XP_004378771.1.4749 XP_004409006.1.74151 XP_004442961.1.5094 XP_004603358.1.94378 XP_004752705.1.14098 XP_005678199.1.57651 XP_005968268.1.78601 XP_006074924.1.26621 XP_006738612.1.47382 XP_007110123.1.24612 XP_007176436.1.59432 XP_007468568.1.90284 XP_007944376.1.48129 XP_008053223.1.4292 XP_008527804.1.77740 XP_008688852.1.72690 XP_010329424.1.74449 XP_010359098.1.97406 XP_010858653.1.44457 XP_011811454.1.43180 XP_011837469.1.47321 XP_011932416.1.92194 XP_012024886.1.54773 XP_014697380.1.49734 XP_014919882.1.86478 XP_015391691.1.5354 XP_017357442.1.71028 XP_017534626.1.32401 XP_019269616.1.44245 XP_019692945.1.62641 XP_019812702.1.53367 XP_020745862.1.74333 XP_021522104.1.9421 XP_021545691.1.83697 XP_537085.1.84170 ENSOGAP00000005144 ENSLAFP00000005113 9544.ENSMMUP00000003745 9598.ENSPTRP00000001610 9600.ENSPPYP00000001365 9606.ENSP00000359531 9615.ENSCAFP00000029978 9823.ENSSSCP00000007384 9913.ENSBTAP00000041650 ENSP00000359531 ENSPTRP00000001610 ENSTTRP00000011289 5iy6_M 5iy7_M 5iy8_M 5iy9_M 5iya_M 5iyb_M 5iyc_M 5iyd_M ENSMMUP00000003745 Hs4504193___KOG1597 ENSMPUP00000004760 ENSBTAP00000041650 ENSCAFP00000029978 gi|4504193|ref|NP_001505.1| ENSP00000359531 ENSGGOP00000020269 ENSLAFP00000019453 ENSBTAP00000041650 ENSPTRP00000001610 ENSMPUP00000004760 ENSGGOP00000014656 ENSMMUP00000003745 ENSP00000359531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]