SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029989 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029989
Domain Number 1 Region: 88-99,174-423
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 15-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029989   Gene: ENSCAFG00000020216   Transcript: ENSCAFT00000032203
Sequence length 437
Comment pep:known_by_projection chromosome:CanFam3.1:9:58385846:58444902:1 gene:ENSCAFG00000020216 transcript:ENSCAFT00000032203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METWEVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNC
VMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEF
EEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELNGFMAFREQYMGMSMPPHY
QYIPHLFSYSTHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAEL
FALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGE
LADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIR
GLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLP
LLFKVVLHSCKTSVGKE
Download sequence
Identical sequences F1PHV1
ENSCAFP00000029989 ENSCAFP00000029989 XP_005625441.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]