SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029991 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029991
Domain Number 1 Region: 2-16,134-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-61
Family Nuclear receptor ligand-binding domain 0.000000141
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000029991
Domain Number - Region: 52-59
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029991   Gene: ENSCAFG00000023086   Transcript: ENSCAFT00000032206
Sequence length 384
Comment pep:novel chromosome:CanFam3.1:9:58463849:58488207:1 gene:ENSCAFG00000023086 transcript:ENSCAFT00000032206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPPPD
YMLPPGLHAPEPKGLASGPPAGPLGDFGAPALPMAVPSAHGPLAGYLYPSFPGRAIKSEY
PEPYASPPQPGPPYGYPEPFSGGPGVPELILQLLQLEPDEDQVRARIVGCLQEPAKGRPD
QPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQIQH
GKDGSILLVTGQEVEMSTVAAQAGSLLHSLVLRAQELVLQLHALQLDRQEFVCLKFLILF
SLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYL
YHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences F1PHU7
ENSCAFP00000029991 ENSCAFP00000029991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]