SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030028 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030028
Domain Number 1 Region: 553-712
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.07e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0089
Further Details:      
 
Domain Number 2 Region: 687-810
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 125-272
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-26
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000030028
Domain Number - Region: 998-1032
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0602
Family Trimerization domain of TRAF 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030028   Gene: ENSCAFG00000020242   Transcript: ENSCAFT00000032243
Sequence length 1069
Comment pep:known_by_projection chromosome:CanFam3.1:9:59693134:59842412:-1 gene:ENSCAFG00000020242 transcript:ENSCAFT00000032243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIIGNGSEQQL
QKELADVLMDPPMDDQPADKELVERSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMS
LPVKPGQGDSEGSSPFTPAADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQI
SLDVTLSVPNVSEGTVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNA
ELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSASAAPQTPDSDIFTFSVSLEIKE
DDGKGYFSAVPKEKDRQCFKLRQGTDKKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNS
DMHLLDLESMGKSSDGKSYVITGSWNPKSLPFQVVNEETPKDKVLFMTTAVDLVITEVQE
PVRSLIETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQKERKNNTDTLYEVVCLESE
SERERRKTTATPSIRLPQSGSQSSMIPSPPEDDEEEDNDEPLLSGFGDVSKECAGKILET
WGELLSKWHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKES
PQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLL
HMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEA
HMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGAL
KFFRVQLPKRYRSEENAKKLMELACSMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEE
EKRRLEDESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIE
KIWQKVDDCERCREFFNKEGRIKGMSSAKEVLDEDTDEEKETLKNQLREMELELAQTKLQ
LVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
Download sequence
Identical sequences F1PC09
ENSCAFP00000030028 XP_005625447.1.84170 XP_005625448.1.84170 XP_537854.2.84170 ENSCAFP00000030028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]