SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030087 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030087
Domain Number 1 Region: 217-328
Classification Level Classification E-value
Superfamily PH domain-like 6.99e-37
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 114-223
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-25
Family PDZ domain 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000030087
Domain Number - Region: 365-464
Classification Level Classification E-value
Superfamily PH domain-like 0.0113
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030087   Gene: ENSCAFG00000020288   Transcript: ENSCAFT00000032309
Sequence length 568
Comment pep:known_by_projection chromosome:CanFam3.1:5:80352534:80461621:-1 gene:ENSCAFG00000020288 transcript:ENSCAFT00000032309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNETPRGERPAPPPRAGRGKRRGCPTGMRVSAAAAAAGAGPAMAVWTRATKAGLVELLL
RERWVRVVAELSGESLSLTGDAAAAEPEAALGPAAAAFNGLPNGGGAGDSLPGSPSRGLG
PPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAAD
QSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSD
LPWEGASPQSPSFSGSEDSGSPKHQNSTKDRKVIPLKMCFAARNLSMPDLENRLIELHSP
DSRNTLILRCKDTATAHSWFVAIYTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWL
AEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCR
SPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSTWTRILVQGCHAAAELIKEVSLGCTL
NGQEVRLTVHYENGFTISKENGGSSSILYRYPFERLKMSADDGIRNLYLDFGGPEGELTM
DLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences F1PBV5
ENSCAFP00000030087 ENSCAFP00000030087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]