SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030088 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030088
Domain Number 1 Region: 349-653
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-90
Family p120GAP domain-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 220-323
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000774
Family PLC-like (P variant) 0.085
Further Details:      
 
Domain Number 3 Region: 168-217
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000146
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030088   Gene: ENSCAFG00000020290   Transcript: ENSCAFT00000032310
Sequence length 1166
Comment pep:known_by_projection chromosome:CanFam3.1:9:60729244:60852976:-1 gene:ENSCAFG00000020290 transcript:ENSCAFT00000032310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGGASARKSPGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSL
PEKSPSMEPSATTPFRVTGFLGRRLKGSIKRTKSQPRLDRNHSFRHILPGFRGAPAPAAA
AAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVT
TSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCE
LCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLV
SLPAASVAGRQFVEKWYPVVTPNPKGTKGPGPMIRIKARYQTITILPMEMYKEFAEHITN
HYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRE
NTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMC
CELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPS
LFNLLQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLE
ISNPETISNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALN
TPGSGQLTGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVT
RSSGVQPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDALTTDG
QTPASQLAAGWPARTAPASLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQ
MAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELTAAAKLGSFSSAAEELSRRPGDLARRQM
SLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLA
SASPDWAGPGARLRQPSSSSKGDSPELKPRVVHKQGPSPVSPNALDRTAAWLLTMNAQLL
EDEGLGPDPPHRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLV
LEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQ
EKRIASLDAANARLMSALTQLKESMH
Download sequence
Identical sequences F1PBV4
ENSCAFP00000038045 ENSCAFP00000030088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]