SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030204 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030204
Domain Number 1 Region: 735-911
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-40
Family DBL homology domain (DH-domain) 0.0000925
Further Details:      
 
Domain Number 2 Region: 921-1036
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-36
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000030204
Domain Number - Region: 188-326
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000275
Family CRAL/TRIO domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030204   Gene: ENSCAFG00000020367   Transcript: ENSCAFT00000032434
Sequence length 1195
Comment pep:known_by_projection chromosome:CanFam3.1:5:82093891:82102168:-1 gene:ENSCAFG00000020367 transcript:ENSCAFT00000032434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPLEVGDESPDSQGHATDWRFAVCSFRDAWDEEESVALKQIKDSNPPGPPAGTAQGSP
LPEELQSPPGQLAVDESGDGQGCTLEGSSLRLDEPIPSGVESLLCPMSSCLSLEQGESDS
QGGGLAGDQLSSRLMPAHLGPGGLTSDPVDLGGPSSEVSSELLEADHSGSSLPKPADYLR
AQDLAWDLLASGMATLPGTRDVEGRAVLLLCAHSPAWLHLKCTSHELLCLLLYLRGIPRP
EVQALGLTVLVDARLCSPSSSLLWALSQLQEAAPGSVYQVLLLGKMPEEVPSGLQLQQLP
SHQSLLNHVSTSGLPASMGGGLPYSHQAWLDFRMRLEALLQSCQVACALLQGAIESMKAV
PQPVESGEVGRLLQQARVLMEHVLDSPRLAWLQCQGGLELAWLKQEVPEVTLSPDYRSAV
DEVDELYGRVDGLLHQLTLQSNRRVRALELVQTLEAQEGGLHQIEVWLQQVGWPALEELK
EPSLDMLLQAKGPFQELDQVAQEQVRRGEKFLQPLAGWEAAELGPAGARFLARQAKLTDF
SRALTRRRQQLADAERLFHLFKQASTWAEEGQRVLAELEQEHPGVVLQRLQLHWTKHPDL
PPAHFRKMWALATGLGSEGIRQECRWAWAQCQDTWLALDQKLEAVLKPPLTTTMTVSTAS
LCVSRVPAASATPPLRKAYSLDQNLGQSLRQPAHHCHHVATAAACHGPEAGGGAQPGSSP
TMPLPSTSDPRSPSRLQLVLAEMVATEQEYVRALDYTIENYFPELDRPDVPQGLRGQRAH
LFGNLEKLRDFHCHFFLRELEACTQHPSRVAYAFLRHRVQFGMYALYSKNKPRSDALMTS
FGHAFFKDKQQALGDHLDLASYLLKPIQRMSKYALLLQELARACGGAVQELSALRAAQSL
VRFQLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFMVRTGRRKSLRRVFLFEELLLFSK
PRRGPTGTDTFTYKRSFKMADLGLTECCGDSNLRFEIWFRRRKARDTFVLQAASLATKQA
WTADISRLLWRQAIHNKEVRMAEMVSMGVGNKAFRDLAPSEEAINDRTVDYVLKCREVRS
RASIAVAPFDCDSRYLGAWSSLPGDPASCSVLGSLNLHLYRDPALLGVRWPLYSTSVPEE
AALEAEVELGSQLSLTPEDSEVSSQCPSVSGSSGSDSSCVSGQVLGRGLEDLSCV
Download sequence
Identical sequences E2RF15
XP_013969571.1.84170 9615.ENSCAFP00000030204 ENSCAFP00000030204 ENSCAFP00000030204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]